Structure of PDB 3lb8 Chain D

Receptor sequence

>3lb8D (length=103) Species: 303 (Pseudomonas putida)

SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHV
YVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVD
VPD

3D structure

• PDB: 3lb8 Crystal structure of the putidaredoxin reductase x putidaredoxin electron transfer complex.
• Chain: D
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	D	M24 G37 C39 G41 A43 S44 C45 C48 C86	M24 G37 C39 G41 A43 S44 C45 C48 C86

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0140647 P450-containing electron transport chain

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3lb8, PDBe:3lb8, PDBj:3lb8
• PDBsum: 3lb8
• PubMed: 20179327
• UniProt: P00259|PUTX_PSEPU Putidaredoxin (Gene Name=camB)