Structure of PDB 3j7q Chain D

Receptor sequence

>3j7qD (length=292) Species: 9823 (Sus scrofa)

FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMI
VRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTG
LLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLAR
TTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHILGQ
NVADYMRYLIEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPV
YEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERA

3D structure

• PDB: 3j7q Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
• Chain: D
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	F3 V4 K5 V6 K8 K10 Y12 K14 R15 Y16 K19 R23 T28 D29 Y31 R35 K43 Y44 K48 Y49 F113 P139 G140 A141 F142 Y145 L150 R152 T153 P174 H175 S176 R179 M271 S272 A274 Q275 D278 R279 Q282 S286 R289	F1 V2 K3 V4 K6 K8 Y10 K12 R13 Y14 K17 R21 T26 D27 Y29 R33 K41 Y42 K46 Y47 F111 P137 G138 A139 F140 Y143 L148 R150 T151 P172 H173 S174 R177 M269 S270 A272 Q273 D276 R277 Q280 S284 R287
BS02	rna	D	K10 F13 K14 Y16 V18 F20 R21 R22 R24 T28 R33 R50 R54 T56 N57 R58 I61 Q63 I69 E70 G71 D72 M73 I74 Y79 N94 Y95 R152 T154 T155 G156 N157 K158 H198 V204 Y207 Q222 F223 S224 Q225 Y253 K255 K256 K258 E260 V261 K262 K263 W266 N267 R268 K270 M271 K276 K277 R279 V280 K284	K8 F11 K12 Y14 V16 F18 R19 R20 R22 T26 R31 R48 R52 T54 N55 R56 I59 Q61 I67 E68 G69 D70 M71 I72 Y77 N92 Y93 R150 T152 T153 G154 N155 K156 H196 V202 Y205 Q220 F221 S222 Q223 Y251 K253 K254 K256 E258 V259 K260 K261 W264 N265 R266 K268 M269 K274 K275 R277 V278 K282

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j7q, PDBe:3j7q, PDBj:3j7q
• PDBsum: 3j7q
• PubMed: 24930395
• UniProt: A0A287ASD0