Structure of PDB 3j6b Chain D

Receptor sequence

>3j6bD (length=239) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PLPNAAIPPKYALVTVRSFPSLEPLTFVPVPTSTVAAPLRRDILWRAVVY
ENDNRRVGASNPPGRSENGFSRRKLMPQKGSGRARVGDANSPTRHNGGRA
LARTAPNDYTTELPSKVYSMAFNNALSHQYKSGKLFVIGGEKVDLISPTP
ELDLNRLDLIFEGEVIFRKFLEEFQLKGKRLLFITDKTREGLIKSSDPYK
QKVDVIQKELVEVNDILRAQAVFIELEALEYLAMAHQKE

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	R70 W75 R76 N82 R86 V87 A89 N91 P92 R95 S96 F100 S101 R102 R103 K104 Q108 K109 G110 G112 R113 A114 R115 S121 P122 T123 R124 H125 R129 L131 R133 P136 T141 E142 P144 S145 K146 V147 R220 P238 R258	R40 W45 R46 N52 R56 V57 A59 N61 P62 R65 S66 F70 S71 R72 R73 K74 Q78 K79 G80 G82 R83 A84 R85 S91 P92 T93 R94 H95 R99 L101 R103 P106 T111 E112 P114 S115 K116 V117 R180 P198 R218

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P51998\|RL4P_YEAST Large ribosomal subunit protein uL4m (Gene Name=YML6)

[Back to BioLiP]