Structure of PDB 3iwn Chain D

Receptor sequence
>3iwnD (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
3D structure
PDB3iwn Recognition of the bacterial second messenger cyclic diguanylate by its cognate riboswitch.
ChainD
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D T901 R965 Q968 G969 R978 Y981 T1 R65 Q68 G69 R78 Y81 PDBbind-CN: Kd=1nM
BS02 rna D Y908 K917 R942 L944 K945 M946 R947 G948 Q949 F951 K983 S986 D987 Y8 K17 R42 L44 K45 M46 R47 G48 Q49 F51 K83 S86 D87 PDBbind-CN: Kd=1nM
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3iwn, PDBe:3iwn, PDBj:3iwn
PDBsum3iwn
PubMed19898478
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]