Structure of PDB 3itj Chain D

Receptor sequence

>3itjD (length=307) Species: 580240 (Saccharomyces cerevisiae W303)

VHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTE
IENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWT
EFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPI
FRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRARAEKNEKIEI
LYNTVALEAKGLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQV
DTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDA
EKYLTSL

3D structure

• PDB: 3itj Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
• Chain: D
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C141 C144 D145
• Catalytic site (residue number reindexed from 1): C141 C144 D145
• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	D	I8 G9 S10 G11 P12 A13 Y31 G33 A36 N37 I39 A40 G43 Q44 T48 I51 N53 T85 V86 T118 G119 C144 G286 D287 R294 Q295 A296 S299	I8 G9 S10 G11 P12 A13 Y31 G33 A36 N37 I39 A40 G43 Q44 T48 I51 N53 T85 V86 T118 G119 C144 G276 D277 R284 Q285 A286 S289

Gene Ontology

Molecular Function

• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0034599 cellular response to oxidative stress
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space
• GO:0005829 cytosol

External links

• PDB: RCSB:3itj, PDBe:3itj, PDBj:3itj
• PDBsum: 3itj
• PubMed: 20235561
• UniProt: P29509|TRXB1_YEAST Thioredoxin reductase 1 (Gene Name=TRR1)