Structure of PDB 3imb Chain D

Receptor sequence

>3imbD (length=238) Species: 54910 (Brevibacillus centrosporus) [Search protein sequence]

MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENN
ITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPSS
RNPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNL
SKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMD
LCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL

3D structure

PDB

3imb Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA

Chain

Resolution

1.89 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	D	V96 L207	V96 L207
BS02	dna	D	E104 M106	E104 M106
BS03	dna	D	D33 G34 G37 Q38 N49 N50 I51 E60 K62 G63 M64 R65 R67 S71 T74 H77 K78 K79 K152 D215 R216 G217 H219 R221	D33 G34 G37 Q38 N49 N50 I51 E60 K62 G63 M64 R65 R67 S71 T74 H77 K78 K79 K152 D215 R216 G217 H219 R221
BS04	dna	D	R30 T31 D32 N50 Y95 K97 S100 R101 K109 F111 T113 K115 R118 N120 N121 D200 C202 H214 R216 H219	R30 T31 D32 N50 Y95 K97 S100 R101 K109 F111 T113 K115 R118 N120 N121 D200 C202 H214 R216 H219

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3imb, PDBe:3imb, PDBj:3imb
PDBsum	3imb
PubMed
UniProt	Q8RNV8

[Back to BioLiP]