Structure of PDB 3iem Chain D

Receptor sequence

>3iemD (length=431) Species: 300852 (Thermus thermophilus HB8)

MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNHAPFGFDPK
EVDAVLLTHAHLDHVGRLPKLFREGYRGPVYATRATVLLMEIVLEDALKV
MDEPFFGPEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGHLPGSAFVVA
QGEGRTLVYSGDLGNREKDVLPDPSLPPLADLVLAEGTYGDRPHRPYRET
VREFLEILEKTLSQGGKVLIPTFAVERAQEILYVLYTHGHRLPRAPIYLD
SPMAGRVLSLYPRLVRYFSEEVQAHFLQGKNPFRPAGLEVVEHTEASKAL
NRAPGPMVVLAGSGMLAGGRILHHLKHGLSDPRNALVFVGYQPQGGLGAE
IIARPPAVRILGEEVPLRASVHTLGGFSGHAGQDELLDWLQGEPRVVLVH
GEEEKLLALGKLLALRGQEVSLARFGEGVPV

3D structure

• PDB: 3iem Crystal Structure of TTHA0252 from Thermus thermophilus HB8 complexed with RNA analog
• Chain: D
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	Q34 H61 L62 D96 A97 V100 M101 Y189 F223 A224 V225 R227 P252 M253 S313 M315 A317 Y341 S378 H380 H400	Q34 H61 L62 D96 A97 V100 M101 Y189 F223 A224 V225 R227 P252 M253 S313 M315 A317 Y341 S378 H380 H400
BS02	rna	D	G46 F47	G46 F47
BS03	ZN	D	D63 H64 D162 H400	D63 H64 D162 H400
BS04	ZN	D	H59 H61 H141 D162	H59 H61 H141 D162

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006364 rRNA processing

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3iem, PDBe:3iem, PDBj:3iem
• PDBsum: 3iem
• UniProt: Q5SLP1|RNSE_THET8 Ribonuclease TTHA0252 (Gene Name=TTHA0252)