Structure of PDB 3ic3 Chain D |
>3ic3D (length=85) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence] |
MTGPKQQPLPPDVEGREDAIEVLRAFVLDGGLSIAFMRAFDPEMWGLLLV DIARHAARSYARESEYTEDEALERIVEMFEAELSR |
|
PDB | 3ic3 Structure of a putative pyruvate dehydrogenase from the photosynthetic bacterium Rhodopseudomonas palustrus CGA009 |
Chain | D |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BGC |
D |
R59 R63 |
R58 R62 |
|
|
|