Structure of PDB 3hw5 Chain D

Receptor sequence

>3hw5D (length=176) Species: 93838 (Influenza A virus (A/goose/Guangdong/1/1996(H5N1)))

PLGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCF
MYSRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIG
VTRREVHTYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARI
KTRLFTIRQEMASRGLWDSFRQSERG

3D structure

• PDB: 3hw5 Nucleoside monophosphate complex structures of the endonuclease domain from the influenza virus polymerase PA subunit reveal the substrate binding site inside the catalytic center
• Chain: D
• Resolution: 1.81 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	D	E80 D108	E59 D87

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:3hw5, PDBe:3hw5, PDBj:3hw5
• PDBsum: 3hw5
• PubMed: 19587036
• UniProt: Q9Q0U9|PA_I96A0 Polymerase acidic protein (Gene Name=PA)