Structure of PDB 3hrw Chain D

Receptor sequence
>3hrwD (length=146) Species: 10090 (Mus musculus) [Search protein sequence]
VHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSS
ASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDP
ENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
3D structure
PDB3hrw Crystal structure of hemoglobin from mouse (Mus musculus) compared with those from other small animals and humans.
ChainD
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D Y41 F42 H63 V67 A70 L88 H92 L96 N102 F103 L106 L141 Y41 F42 H63 V67 A70 L88 H92 L96 N102 F103 L106 L141
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0030097 hemopoiesis
GO:0030185 nitric oxide transport
GO:0048821 erythrocyte development
Cellular Component
GO:0005833 hemoglobin complex
GO:0043209 myelin sheath

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3hrw, PDBe:3hrw, PDBj:3hrw
PDBsum3hrw
PubMed33830076
UniProtP02088|HBB1_MOUSE Hemoglobin subunit beta-1 (Gene Name=Hbb-b1)

[Back to BioLiP]