Structure of PDB 3he3 Chain D

Receptor sequence

>3he3D (length=362) Species: 1299 (Deinococcus radiodurans)

KGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGV
LIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLD
TVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFR
GYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQ
NMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSL
EFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYP
RAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVV
AQALATFRRLQG

3D structure

• PDB: 3he3 Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: D
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R171 R175 R248 R278 E298 Y343 N345
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	D	F176 Y179 T180 W184 V195 Y209 N296 R305 Y370	F149 Y152 T153 W157 V168 Y182 N269 R278 Y343
BS02	FAD	D	V35 G36 G38 A40 D59 R60 R61 G66 N67 P84 H85 I86 D242 Y243 Y334 R364 Y371 N372 M373 V376	V8 G9 G11 A13 D32 R33 R34 G39 N40 P57 H58 I59 D215 Y216 Y307 R337 Y344 N345 M346 V349

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3he3, PDBe:3he3, PDBj:3he3
• PDBsum: 3he3
• PubMed: 19836401
• UniProt: Q9RYF1