Structure of PDB 3h90 Chain D

Receptor sequence
>3h90D (length=283) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
LVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNL
LVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLIS
PTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSD
VMMNGAILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLD
RALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDSLPL
VQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV
3D structure
PDB3h90 Structural basis for autoregulation of the zinc transporter YiiP.
ChainD
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D H283 D285 H276 D278
BS02 ZN D D68 H71 H75 D61 H64 H68
BS03 ZN D H232 H248 D285 H225 H241 D278
BS04 ZN D D45 D49 H153 D157 D38 D42 H146 D150
Gene Ontology
Molecular Function
GO:0005381 iron ion transmembrane transporter activity
GO:0005385 zinc ion transmembrane transporter activity
GO:0008324 monoatomic cation transmembrane transporter activity
GO:0015086 cadmium ion transmembrane transporter activity
GO:0015093 ferrous iron transmembrane transporter activity
GO:0015297 antiporter activity
GO:0015341 zinc efflux active transmembrane transporter activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0046873 metal ion transmembrane transporter activity
GO:0140826 zinc:proton antiporter activity
Biological Process
GO:0006812 monoatomic cation transport
GO:0006826 iron ion transport
GO:0006829 zinc ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006882 intracellular zinc ion homeostasis
GO:0034755 iron ion transmembrane transport
GO:0055085 transmembrane transport
GO:0070574 cadmium ion transmembrane transport
GO:0071577 zinc ion transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3h90, PDBe:3h90, PDBj:3h90
PDBsum3h90
PubMed19749753
UniProtP69380|FIEF_ECOLI Cation-efflux pump FieF (Gene Name=fieF)

[Back to BioLiP]