Structure of PDB 3gqp Chain D

Receptor sequence

>3gqpD (length=145) Species: 9685 (Felis catus)

FLTAEEKGLVNGLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSSA
DAIMSNAKVKAHGKKVLNSFSDGLKNIDDLKGAFAKLSELHCDKLHVDPE
NFRLLGNVLVCVLAHHFGHDFNPQVQAAFQKVVAGVANALAHKYH

3D structure

• PDB: 3gqp Crystallization of sheep (Ovis aries) and goat (Capra hircus) haemoglobins under unbuffered low-salt conditions
• Chain: D
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	F41 F42 H63 S70 H92 L96 V98 N102 F103 L106 L141	F40 F41 H62 S69 H91 L95 V97 N101 F102 L105 L140

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:3gqp, PDBe:3gqp, PDBj:3gqp
• PDBsum: 3gqp
• UniProt: P07412|HBB_FELCA Hemoglobin subunit beta-A/B (Gene Name=HBB)