Structure of PDB 3gqg Chain D

Receptor sequence

>3gqgD (length=146) Species: 40690 (Trematomus bernacchii)

VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYN
AEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDP
DNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH

3D structure

• PDB: 3gqg Correlation between hemichrome stability and the root effect in tetrameric hemoglobins.
• Chain: D
• Resolution: 1.73 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	H41 H63 V67 L91 H92 L96 N102 F103 L141	H41 H63 V67 L91 H92 L96 N102 F103 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3gqg, PDBe:3gqg, PDBj:3gqg
• PDBsum: 3gqg
• PubMed: 19651045
• UniProt: P80044|HBB_TREBE Hemoglobin subunit beta (Gene Name=hbb)