Structure of PDB 3fhz Chain D

Receptor sequence
>3fhzD (length=166) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
KAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQA
TLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGEL
LVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAR
EPTTGAQLAGMFENLR
3D structure
PDB3fhz The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine.
ChainD
Resolution3.27 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R18 R21 T52 T55 R58 R99 R14 R17 T48 T51 R54 R95
BS02 dna D S36 Q37 Q53 A54 S57 Y78 S32 Q33 Q49 A50 S53 Y74
BS03 ARG D H125 S129 D132 T142 I143 H121 S125 D128 T138 I139
BS04 ARG D G145 D146 D147 T148 G141 D142 D143 T144
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0034618 arginine binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006525 arginine metabolic process
GO:0006526 L-arginine biosynthetic process
GO:0051259 protein complex oligomerization
GO:1900079 regulation of arginine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fhz, PDBe:3fhz, PDBj:3fhz
PDBsum3fhz
PubMed19265706
UniProtP9WPY9|ARGR_MYCTU Arginine repressor (Gene Name=argR)

[Back to BioLiP]