Structure of PDB 3fbd Chain D

Receptor sequence
>3fbdD (length=131) Species: 562 (Escherichia coli) [Search protein sequence]
KRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFQDF
RKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHH
EKPISQNGGVYDMDNISVVTPKRHIDIHRGK
3D structure
PDB3fbd Redesign of high-affinity nonspecific nucleases with altered sequence preference
ChainD
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R447 R538 E542 H544 H545 H569 H573
Catalytic site (residue number reindexed from 1) R2 R93 E97 H99 H100 H124 H128
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R447 R496 A526 S540 E542 L543 H544 H545 S550 R2 R51 A81 S95 E97 L98 H99 H100 S105
BS02 dna D G536 K537 R538 R574 G91 K92 R93 R129
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3fbd, PDBe:3fbd, PDBj:3fbd
PDBsum3fbd
PubMed
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]