Structure of PDB 3f7g Chain D |
>3f7gD (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] |
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETH |
|
PDB | 3f7g Orally bioavailable antagonists of inhibitor of apoptosis proteins based on an azabicyclooctane scaffold |
Chain | D |
Resolution | 2.3 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
F81 |
Catalytic site (residue number reindexed from 1) |
F11 |
Enzyme Commision number |
2.3.2.27: RING-type E3 ubiquitin transferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
C124 C127 H144 C151 |
C54 C57 H74 C81 |
|
|
|