Structure of PDB 3eu1 Chain D

Receptor sequence
>3eu1D (length=145) Species: 9925 (Capra hircus) [Search protein sequence]
MLTAEEKAAVTGFWGKVKVDEVGAEALGRLLVVYPWTQRFFEHFGDLSSA
DAVMNNAKVKAHGKKVLDSFSNGMKHLDDLKGTFAQLSELHCDKLHVDPE
NFKLLGNVLVVVLARHHGSEFTPLLQAEFQKVVAGVANALAHRYH
3D structure
PDB3eu1 Purification, crystallization and preliminary X-ray diffraction studies on goat (Capra hircus) hemoglobin - a low oxygen affinity species
ChainD
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D F41 F42 H44 H63 K66 V67 S70 H92 L96 V98 L106 L141 F40 F41 H43 H62 K65 V66 S69 H91 L95 V97 L105 L140
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3eu1, PDBe:3eu1, PDBj:3eu1
PDBsum3eu1
PubMed19356147
UniProtP02077|HBBA_CAPHI Hemoglobin subunit beta-A

[Back to BioLiP]