Structure of PDB 3e00 Chain D

Receptor sequence

>3e00D (length=363) Species: 9606 (Homo sapiens)

MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHK
KSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNP
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLM
MGEDKIKFQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQ
VTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFM
EPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLL
QALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMS
LHPLLQEIYKDLY

3D structure

• PDB: 3e00 Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
• Chain: D
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	F121 H122 Y123 K132 R136 H177 I180 F182 G183 R184	F15 H16 Y17 K26 R30 H71 I74 F76 G77 R78
BS02	dna	D	E129 F134 R137 R159 N160 Q163 R166 F182 G183 R184	E23 F28 R31 R53 N54 Q57 R60 F76 G77 R78
BS03	peptide	D	K301 L311 Q314 V315 E471	K187 L197 Q200 V201 E357
BS04	ZN	D	C111 C114 C128	C5 C8 C22
BS05	ZN	D	C148 C162	C42 C56
BS06	GW9	D	F282 C285 S289 L330 Y473	F168 C171 S175 L216 Y359	BindingDB: EC50=2.0nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0004879 nuclear receptor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3e00, PDBe:3e00, PDBj:3e00
• PDBsum: 3e00
• PubMed: 19043829
• UniProt: P37231|PPARG_HUMAN Peroxisome proliferator-activated receptor gamma (Gene Name=PPARG)