Structure of PDB 3ccj Chain D

Receptor sequence

>3ccjD (length=140) Species: 2238 (Haloarcula marismortui)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

3D structure

• PDB: 3ccj Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
• Chain: D
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K20 H24 T52 K53 R56 E60 Q97 F98 D99 T101 F104 S105 G107 D129 N133 Y139 R156	K11 H15 T38 K39 R42 E46 Q83 F84 D85 T87 F90 S91 G93 D95 N99 Y105 R122
BS02	rna	D	F10 E12 M13 R17 Q47 M48 V50 K72 V73 T74 R76 P137 G138 R140 V141 R144 D145 P152 K154 H155	F1 E3 M4 R8 Q33 M34 V36 K58 V59 T60 R62 P103 G104 R106 V107 R110 D111 P118 K120 H121

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3ccj, PDBe:3ccj, PDBj:3ccj
• PDBsum: 3ccj
• PubMed: 18455733
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)