Structure of PDB 3b0v Chain D

Receptor sequence

>3b0vD (length=315) Species: 300852 (Thermus thermophilus HB8)

MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERL
LAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQE
GGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSV
EAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTF
VTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPS
RLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGR
SLQALDRALRLMEEE

3D structure

• PDB: 3b0v Molecular basis of dihydrouridine formation on tRNA
• Chain: D
• Resolution: 3.51 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.-
  1.3.1.91: tRNA-dihydrouridine(20) synthase [NAD(P)(+)].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	V12 R14 M36 V38 Q40 N46 C93 S95 K97 E100 G101 Y103 T174 R178 R284 G285 R286 K288 G289 R290 R293 R294 S297 R300	V12 R14 M36 V38 Q40 N46 C93 S95 K97 E100 G101 Y103 T174 R178 R284 G285 R286 K288 G289 R290 R293 R294 S297 R300
BS02	FMN	D	P10 M11 V12 M36 Q63 N90 K132 H164 R178 N203 G225 R226	P10 M11 V12 M36 Q63 N90 K132 H164 R178 N203 G225 R226

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000166 nucleotide binding
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0017150 tRNA dihydrouridine synthase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0102264 tRNA-dihydrouridine20 synthase activity
• GO:0102266 tRNA-dihydrouridine20a synthase activity

Biological Process

• GO:0002943 tRNA dihydrouridine synthesis
• GO:0008033 tRNA processing

External links

• PDB: RCSB:3b0v, PDBe:3b0v, PDBj:3b0v
• PDBsum: 3b0v
• PubMed: 22123979
• UniProt: Q5SMC7|DUSAL_THET8 tRNA-dihydrouridine(20/20a) synthase (Gene Name=dus)