Structure of PDB 3aqc Chain D

Receptor sequence

>3aqcD (length=325) Species: 1270 (Micrococcus luteus)

MIALSYKAFLNPYIIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPM
FVLLSGFLNDTQKDDLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVH
IAFDKDTAIRTGHFLLARALQNIATINNSKFHQIFSKTILEVCFGEFDQM
ADRFNYPVSFTAYLRRINRKTAILIEASCHLGALSSQLDEQSTYHIKQFG
HCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAIANLKEQ
DDDKLEAVVKHLTSTSDDEVYQYIVSQVKQYGIEPAELLSRKYGDKAKYH
LSQLQDSNIKDYLEEIHEKMLKRVY

3D structure

• PDB: 3aqc Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
• Chain: D
• Resolution: 2.61 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.83: hexaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	D	D84 D88	D84 D88
BS02	MG	D	D84 D88	D84 D88
BS03	2DE	D	S80 D84 R93 E146 K170	S80 D84 R93 E146 K170

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0036423 hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0009234 menaquinone biosynthetic process

External links

• PDB: RCSB:3aqc, PDBe:3aqc, PDBj:3aqc
• PDBsum: 3aqc
• PubMed: 21068379
• UniProt: O66129|HEXB_MICLU Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) (Gene Name=hexs-b)