Structure of PDB 3a7k Chain D

Receptor sequence
>3a7kD (length=259) Species: 348780 (Natronomonas pharaonis DSM 2160) [Search protein sequence]
VTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLDDPRAKLIA
VSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGVV
TMWGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAAL
TTSSHLMRWFWYAISCACFIVVLYILLVEWAQDAKAAGTADIFSTLKLLT
VVMWLGYPIVWALGVEGVAVLPVGYTSWAYSALDIVAKYIFAFLLLNYLT
SNEGVVSGS
3D structure
PDB3a7k Crystal Structure of the Light-Driven Chloride Pump Halorhodopsin from Natronomonas pharaonis.
ChainD
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 22B D F155 V189 E197 F137 V171 E179
BS02 22B D G46 T56 K65 G28 T38 K47
BS03 RET D W127 T131 M159 Y180 S183 W222 Y225 P226 W229 D252 K256 W109 T113 M141 Y162 S165 W204 Y207 P208 W211 D234 K238
BS04 CL D T126 S130 K256 T108 S112 K238
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 05:14:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3a7k', asym_id = 'D', title = 'Crystal Structure of the Light-Driven Chloride Pump Halorhodopsin from Natronomonas pharaonis.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3a7k', asym_id='D', title='Crystal Structure of the Light-Driven Chloride Pump Halorhodopsin from Natronomonas pharaonis.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005216,0006811,0016020', uniprot = '', pdbid = '3a7k', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005216,0006811,0016020', uniprot='', pdbid='3a7k', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>