Structure of PDB 2zs1 Chain D

Receptor sequence

>2zs1D (length=145) Species: 55676 (Oligobrachia mashikoi)

ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMF
PGGGDSSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAIS
GVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL

3D structure

• PDB: 2zs1 Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin
• Chain: D
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	F39 M49 F50 P51 Q64 Q95 H96 I99 A106 V107 L110 I141	F39 M49 F50 P51 Q64 Q95 H96 I99 A106 V107 L110 I141
BS02	OXY	D	F36 Q64 V68	F36 Q64 V68

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:2zs1, PDBe:2zs1, PDBj:2zs1
• PDBsum: 2zs1
• PubMed: 18834142
• UniProt: Q5KSB7|GLBB1_OLIMA Extracellular giant hemoglobin major globin subunit B1 (Gene Name=ghbB1)