Structure of PDB 2zjr Chain D

Receptor sequence

>2zjrD (length=177) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK

3D structure

PDB

2zjr Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.

Chain

Resolution

2.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	N37 S43 K44 T68 K71 S75 F77 L79 K88 F122 D123 R125 N129 L130 G131 I132 D153 T155	N35 S41 K42 T66 K69 S73 F75 L77 K86 F120 D121 R123 N127 L128 G129 I130 D151 T153
BS02	rna	D	S23 S24 M26 A27 Q63 K64 I66 K69 K88 V89 T90 R92	S21 S22 M24 A25 Q61 K62 I64 K67 K86 V87 T88 R90

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2zjr, PDBe:2zjr, PDBj:2zjr
PDBsum	2zjr
PubMed	18406324
UniProt	Q9RXJ0\|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]