Structure of PDB 2zjq Chain D

Receptor sequence
>2zjqD (length=177) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK
3D structure
PDB2zjq Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
ChainD
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D N37 S43 K44 T68 K71 S75 F77 L79 K88 F122 D123 R125 N129 G131 I132 K133 D153 T155 N35 S41 K42 T66 K69 S73 F75 L77 K86 F120 D121 R123 N127 G129 I130 K131 D151 T153
BS02 rna D S24 M26 A27 Q63 K64 I66 K69 K88 V89 T90 R92 S22 M24 A25 Q61 K62 I64 K67 K86 V87 T88 R90
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zjq, PDBe:2zjq, PDBj:2zjq
PDBsum2zjq
PubMed18406324
UniProtQ9RXJ0|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]