Structure of PDB 2zdo Chain D

Receptor sequence

>2zdoD (length=109) Species: 1280 (Staphylococcus aureus)

STMKFMAEARLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQED
FDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVIT
YDIGYSYMK

3D structure

• PDB: 2zdo Ruffling of Metalloporphyrins Bound to IsdG and IsdI, Two Heme-degrading Enzymes in Staphylococcus aureus
• Chain: D
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.14.99.48: heme oxygenase (staphylobilin-producing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	A5 A7 R22 F23 R26 H27 I29 I54 T56 W67 A76 H77 V80 N94	A7 A9 R24 F25 R28 H29 I31 I56 T58 W69 A78 H79 V82 N96

Gene Ontology

Molecular Function

• GO:0004392 heme oxygenase (decyclizing) activity
• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0033212 iron import into cell
• GO:0042167 heme catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2zdo, PDBe:2zdo, PDBj:2zdo
• PDBsum: 2zdo
• PubMed: 18713745
• UniProt: Q7A649|HDOX1_STAAN Heme oxygenase (staphylobilin-producing) 1 (Gene Name=isdG)