Structure of PDB 2xul Chain D

Receptor sequence

>2xulD (length=106) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805)

MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQYTVEFLQK
LKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKN
ADAISA

3D structure

• PDB: 2xul Mechanism of 2-Oxoglutarate Signaling by the Synechococcus Elongatus Pii Signal Transduction Protein
• Chain: D
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	D	I7 G35 F36 G37 R38 Q39 I86 G87 G89 K90 F92	I7 G35 F36 G37 R38 Q39 I78 G79 G81 K82 F84
BS02	AKG	D	F36 G37 Q39 K40 G41 L56 K58 I86 G87	F36 G37 Q39 K40 G41 L48 K50 I78 G79
BS03	ATP	D	G27 M28 T29 V64 R101 R103	G27 M28 T29 V56 R93 R95

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0030234 enzyme regulator activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006808 regulation of nitrogen utilization

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2xul, PDBe:2xul, PDBj:2xul
• PDBsum: 2xul
• PubMed: 21041661
• UniProt: P0A3F4|GLNB_SYNE7 Nitrogen regulatory protein P-II (Gene Name=glnB)