Structure of PDB 2xqc Chain D

Receptor sequence

>2xqcD (length=132) Species: 1299 (Deinococcus radiodurans)

EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEV
ITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWG
GNLWNPSYCILTVSENTRAQIQKYIESQHDKE

3D structure

• PDB: 2xqc DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
• Chain: D
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	K12 R14 Y16 V17 Q77	K4 R6 Y8 V9 Q69
BS02	dna	D	I133 Q136 H137	I125 Q128 H129
BS03	dna	D	K29 Y30 P81 V84 K85 K88 G89 A90 A92 R93 G109 N110 L111 W112 N113 P114 S115 Y116	K21 Y22 P73 V76 K77 K80 G81 A82 A84 R85 G101 N102 L103 W104 N105 P106 S107 Y108
BS04	dna	D	I25 Y30 R31 H32 H67 H69 K105 L106 W107 C117	I17 Y22 R23 H24 H59 H61 K97 L98 W99 C109
BS05	ZN	D	H67 H69	H59 H61

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004803 transposase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006310 DNA recombination
• GO:0006313 DNA transposition
• GO:0032196 transposition

External links

• PDB: RCSB:2xqc, PDBe:2xqc, PDBj:2xqc
• PDBsum: 2xqc
• PubMed: 20890269
• UniProt: Q7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)