Structure of PDB 2we4 Chain D

Receptor sequence

>2we4D (length=309) Species: 1351 (Enterococcus faecalis)

GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGN
GPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKA
GIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKE
DAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELK
GVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTV
AELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGD
EIVGTVVTK

3D structure

• PDB: 2we4 Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site-Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
• Chain: D
• Resolution: 2.02 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G11 N12 K128 K209 K271
• Catalytic site (residue number reindexed from 1): G10 N11 K127 K208 K270
• Enzyme Commision number: 2.7.2.2: carbamate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	D	G10 G11 N12 G50 G52 K128 K209	G9 G10 N11 G49 G51 K127 K208
BS02	SO4	D	R155 R158	R154 R157
BS03	SO4	D	I236 N237 H262 F263	I235 N236 H261 F262

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0008804 carbamate kinase activity
• GO:0016301 kinase activity

Biological Process

• GO:0006525 arginine metabolic process
• GO:0016310 phosphorylation
• GO:0019546 arginine deiminase pathway

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2we4, PDBe:2we4, PDBj:2we4
• PDBsum: 2we4
• PubMed: 20188742
• UniProt: P0A2X7|ARCC1_ENTFA Carbamate kinase 1 (Gene Name=arcC1)