Structure of PDB 2wdq Chain D

Receptor sequence

>2wdqD (length=105) Species: 562 (Escherichia coli)

NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFV
VVWGV

3D structure

• PDB: 2wdq Structure of Escherichia coli succinate:quinone oxidoreductase with an occupied and empty quinone-binding site.
• Chain: D
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	V19 A23 H71 G75	V9 A13 H61 G65

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0017004 cytochrome complex assembly
• GO:0019646 aerobic electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:2wdq, PDBe:2wdq, PDBj:2wdq
• PDBsum: 2wdq
• PubMed: 19710024
• UniProt: P0AC44|DHSD_ECOLI Succinate dehydrogenase hydrophobic membrane anchor subunit (Gene Name=sdhD)