Structure of PDB 2v21 Chain D |
>2v21D (length=67) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
GKVYKKVELVGTSEEGLEAAIQAALARARKTLRHLDWFEVKEIRGTIGEA GVKEYQVVLEVGFRLEE |
|
PDB | 2v21 The Dodecin from Thermus Thermophilus, a Bifunctional Cofactor Storage Protein. |
Chain | D |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FMN |
D |
R45 T47 Q57 |
R44 T46 Q56 |
|
|
|
|