Structure of PDB 2rc6 Chain D

Receptor sequence

>2rc6D (length=306) Species: 173 (Leptospira interrogans)

PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLA
IDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFG
MKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFL
LPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYS
DELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEA
VKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQ
LFVETY

3D structure

• PDB: 2rc6 Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
• Chain: D
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y96 S97 C272 E312 Y314
• Catalytic site (residue number reindexed from 1): Y90 S91 C264 E304 Y306
• Enzyme Commision number: 1.18.1.2: ferredoxin--NADP(+) reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	D	R94 L95 Y96 S97 I115 I116 D119 I121 F130 G132 V133 C134 S135 T175 E312 Y314	R88 L89 Y90 S91 I109 I110 D113 I115 F122 G124 V125 C126 S127 T167 E304 Y306
BS02	NAP	D	K117 T173 G174 A205 P206 S234 R235 R245 Y247 P275 M278	K111 T165 G166 A197 P198 S226 R227 R237 Y239 P267 M270

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:2rc6, PDBe:2rc6, PDBj:2rc6
• PDBsum: 2rc6
• PubMed: 17958910
• UniProt: Q8EY89