Structure of PDB 2qu0 Chain D

Receptor sequence

>2qu0D (length=145) Species: 9940 (Ovis aries)

MLTAEEKAAVTGFWGKVKVDEVGAEALGRLLVVYPWTQRFFEHFGDLSNA
DAVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAQLSELHCDKLHVDPE
NFRLLGNVLVVVLARHHGNEFTPVLQADFQKVVAGVANALAHKYH

3D structure

• PDB: 2qu0 Crystal structure determination of sheep(Ovis aries) methemoglobin at 2.7 angstrom resolution
• Chain: D
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	F41 F42 H44 F45 H63 H92 L96 N102 L106	F40 F41 H43 F44 H62 H91 L95 N101 L105

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:2qu0, PDBe:2qu0, PDBj:2qu0
• PDBsum: 2qu0
• UniProt: P02075|HBB_SHEEP Hemoglobin subunit beta (Gene Name=HBB)