Structure of PDB 2qc8 Chain D

Receptor sequence

>2qc8D (length=356) Species: 9606 (Homo sapiens) [Search protein sequence]

NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPE
WNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPA
ETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQG
PYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTK
AMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNI
NDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTC
LLNETG

3D structure

PDB

2qc8 Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.1.225: protein S-acyltransferase.
6.3.1.2: glutamine synthetase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MN	D	E136 E196 E203	E127 E187 E194
BS02	MN	D	E134 H253 E338	E125 H244 E329
BS03	MN	D	E134 E203	E125 E194
BS04	ADP	D	W130 G132 E134 Q205 G207 P208 N255 S257 R324 Y336 E338	W121 G123 E125 Q196 G198 P199 N246 S248 R315 Y327 E329
BS05	P3S	D	E134 E136 E196 E203 H253 R299 E305 R319 R340	E125 E127 E187 E194 H244 R290 E296 R310 R331

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0004356	glutamine synthetase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016740	transferase activity
GO:0016874	ligase activity
GO:0019706	protein-cysteine S-palmitoyltransferase activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0001525	angiogenesis
GO:0006538	glutamate catabolic process
GO:0006542	glutamine biosynthetic process
GO:0008283	cell population proliferation
GO:0009267	cellular response to starvation
GO:0009749	response to glucose
GO:0010594	regulation of endothelial cell migration
GO:0018345	protein palmitoylation
GO:0042254	ribosome biogenesis
GO:1903670	regulation of sprouting angiogenesis
GO:1904749	regulation of protein localization to nucleolus

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0044297	cell body
GO:0070062	extracellular exosome
GO:0097386	glial cell projection

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2qc8, PDBe:2qc8, PDBj:2qc8
PDBsum	2qc8
PubMed	18005987
UniProt	P15104\|GLNA_HUMAN Glutamine synthetase (Gene Name=GLUL)

[Back to BioLiP]