Structure of PDB 2qa4 Chain D

Receptor sequence

>2qa4D (length=140) Species: 2238 (Haloarcula marismortui)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

3D structure

• PDB: 2qa4 Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
• Chain: D
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K20 V22 H24 G26 I27 T52 A54 R56 E60 K72 S96 Q97 D99 D100 T101 F104 S105 G107 D129 Y139 R156	K11 V13 H15 G17 I18 T38 A40 R42 E46 K58 S82 Q83 D85 D86 T87 F90 S91 G93 D95 Y105 R122
BS02	rna	D	M13 Q47 M48 P49 V50 K72 V73 T74 R76 P137 R140 V141 R149 P152 K154 H155	M4 Q33 M34 P35 V36 K58 V59 T60 R62 P103 R106 V107 R115 P118 K120 H121

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2qa4, PDBe:2qa4, PDBj:2qa4
• PDBsum: 2qa4
• PubMed: 17599351
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)