Structure of PDB 2pvo Chain D

Receptor sequence

>2pvoD (length=96) Species: 1143 (Synechocystis sp.)

ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGK
ITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY

3D structure

• PDB: 2pvo Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
• Chain: D
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	D	S38 C39 R40 G42 A43 C44 C47 C77	S38 C39 R40 G42 A43 C44 C47 C77

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0022900 electron transport chain

External links

• PDB: RCSB:2pvo, PDBe:2pvo, PDBj:2pvo
• PDBsum: 2pvo
• PubMed: 17611542
• UniProt: P27320|FER_SYNY3 Ferredoxin-1 (Gene Name=petF)