Structure of PDB 2p80 Chain D |
>2p80D (length=123) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIP EGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLD QIVSAKKPKIVQERLEKVIASAK |
|
PDB | 2p80 Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR. |
Chain | D |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
D |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|