Structure of PDB 2otj Chain D

Receptor sequence

>2otjD (length=140) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

3D structure

PDB

2otj The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K20 V22 H24 I27 T52 R56 E60 K72 Q97 D99 D100 T101 S105 F106 G107 D129 T131 N133 Y139 R156	K11 V13 H15 I18 T38 R42 E46 K58 Q83 D85 D86 T87 S91 F92 G93 D95 T97 N99 Y105 R122	PDBbind-CN: Kd=2nM
BS02	rna	D	E12 M13 Q47 M48 P49 V50 V73 T74 R76 P137 G138 R140 V141 R144 D145 R149 P152 H155	E3 M4 Q33 M34 P35 V36 V59 T60 R62 P103 G104 R106 V107 R110 D111 R115 P118 H121	PDBbind-CN: Kd=2nM

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2otj, PDBe:2otj, PDBj:2otj
PDBsum	2otj
PubMed	17321546
UniProt	P14124\|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)

[Back to BioLiP]