Structure of PDB 2o39 Chain D |
>2o39D (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] |
CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNH TWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLI GEEILYCELKGSVAIWSGKPPICEKV |
|
PDB | 2o39 Adenovirus type 11 binding alters the conformation of its receptor CD46. |
Chain | D |
Resolution | 2.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
D |
D57 D58 |
D57 D58 |
|
BS02 |
CA |
D |
D70 A76 |
D70 A76 |
|
|
|