Structure of PDB 2np6 Chain D

Receptor sequence

>2np6D (length=393) Species: 271 (Thermus aquaticus)

VETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVGV
EIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIH
VFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWLV
LEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDT
QESESGFTPILWAEYPHWEGEIIRFETEETRKLEISGMPLGDLFHIRFAA
RSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAK
ELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSS
LVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT

3D structure

• PDB: 2np6 Differential binding of s-adenosylmethionine, s-adenosylhomocysteine and sinefungin to the adenine-specific DNA methyltransferase M.Taqi
• Chain: D
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	Y108 K139 T167 L171 E172 D173 K199 K200 F268 R271 H394	Y88 K119 T147 L151 E152 D153 K179 K180 F248 R251 H374
BS02	dna	D	G112 E113 K116 Y117 K126 K130 G138 K139 K200 R271 S272 G295 R296 T336 K337 R353 E354 P393	G92 E93 K96 Y97 K106 K110 G118 K119 K180 R251 S252 G275 R276 T316 K317 R333 E334 P373
BS03	NEA	D	V21 A47 E71 I72 D89 F90 N105 P107 F146	V1 A27 E51 I52 D69 F70 N85 P87 F126

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity

Biological Process

• GO:0006304 DNA modification
• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2np6, PDBe:2np6, PDBj:2np6
• PDBsum: 2np6
• UniProt: P14385|MTTA_THEAQ Type II methyltransferase M.TaqI (Gene Name=taqIM)