Structure of PDB 2jg3 Chain D

Receptor sequence

>2jg3D (length=391) Species: 271 (Thermus aquaticus)

TPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVGVEI
DPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIHVF
KAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWLVLE
DFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQE
SESGFTPILWAEYPHWEGEIIRFETEETRKLEISGMPLGDLFHIRFAARS
PEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAKEL
RDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSSLV
QWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT

3D structure

• PDB: 2jg3 Quantitative Labeling of Long Plasmid DNA with Nanometer Precision.
• Chain: D
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N105 P106 Y108 F196
• Catalytic site (residue number reindexed from 1): N83 P84 Y86 F174
• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	Y108 K116 K139 T167 L171 E172 D173 K199 K200 F268 R271 H394 T413	Y86 K94 K117 T145 L149 E150 D151 K177 K178 F246 R249 H372 T391
BS02	dna	D	G112 E113 K116 Y117 K126 K130 G138 R271 S272 P273 K276 G295 R296 T336 K337 R353 E354 P393	G90 E91 K94 Y95 K104 K108 G116 R249 S250 P251 K254 G273 R274 T314 K315 R331 E332 P371
BS03	BA2	D	A47 E71 I72 D89 F90 P107 F146	A25 E49 I50 D67 F68 P85 F124

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity

Biological Process

• GO:0006304 DNA modification
• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2jg3, PDBe:2jg3, PDBj:2jg3
• PDBsum: 2jg3
• PubMed: 17654629
• UniProt: P14385|MTTA_THEAQ Type II methyltransferase M.TaqI (Gene Name=taqIM)