Structure of PDB 2ibt Chain D

Receptor sequence

>2ibtD (length=393) Species: 271 (Thermus aquaticus)

VETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVGV
EIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIH
VFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWLV
LEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDT
QESESGFTPILWAEYPHWEGEIIRFETEETRKLEISGMPLGDLFHIRFAA
RSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAK
ELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSS
LVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT

3D structure

• PDB: 2ibt 2-Aminopurine Flipped into the Active Site of the Adenine-Specific DNA Methyltransferase M.TaqI: Crystal Structures and Time-Resolved Fluorescence
• Chain: D
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	V21 N105 Y108 K139 T167 L171 E172 D173 F196 K199 K200 R267 F268 R271 H394	V1 N85 Y88 K119 T147 L151 E152 D153 F176 K179 K180 R247 F248 R251 H374	PDBbind-CN: Kd=0.5uM
BS02	dna	D	G112 E113 K116 Y117 K126 K130 G138 R271 S272 K276 G295 R296 T336 K337 R353 E354	G92 E93 K96 Y97 K106 K110 G118 R251 S252 K256 G275 R276 T316 K317 R333 E334	PDBbind-CN: Kd=0.5uM
BS03	NEA	D	V21 A47 E71 I72 D89 F90 N105 P107 F146	V1 A27 E51 I52 D69 F70 N85 P87 F126

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity

Biological Process

• GO:0006304 DNA modification
• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2ibt, PDBe:2ibt, PDBj:2ibt
• PDBsum: 2ibt
• PubMed: 17455934
• UniProt: P14385|MTTA_THEAQ Type II methyltransferase M.TaqI (Gene Name=taqIM)