Structure of PDB 2i2r Chain D |
>2i2rD (length=122) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
AGVAAWLPFARAAAIGWMRQDELIVLNVSGRRFQTWRTTLERYPDTLLGS TEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDEL AFYGILPEIIGDCCYEEYKDRK |
|
PDB | 2i2r Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer |
Chain | D |
Resolution | 3.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
H104 C131 C132 |
H86 C113 C114 |
|
|
|
|