Structure of PDB 2hzv Chain D

Receptor sequence
>2hzvD (length=131) Species: 562 (Escherichia coli) [Search protein sequence]
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGT
QGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAV
LKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
3D structure
PDB2hzv NikR-operator complex structure and the mechanism of repressor activation by metal ions.
ChainD
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T5 T7 T5 T7
BS02 dna D M1 R3 N27 R28 S29 R33 R65 M1 R3 N27 R28 S29 R33 R65
BS03 NI D H87 H89 C95 H87 H89 C95
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016151 nickel cation binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010045 response to nickel cation
GO:2000143 negative regulation of DNA-templated transcription initiation
Cellular Component
GO:0005667 transcription regulator complex
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hzv, PDBe:2hzv, PDBj:2hzv
PDBsum2hzv
PubMed16945905
UniProtP0A6Z6|NIKR_ECOLI Nickel-responsive regulator (Gene Name=nikR)

[Back to BioLiP]