Structure of PDB 2hrd Chain D

Receptor sequence

>2hrdD (length=244) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSW
RAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHIN
VGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHV
GVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLL
TMCASQGLRAGMVAGVIVNRTQQEIPNAESHAVKIVVEAARRLL

3D structure

• PDB: 2hrd Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 1.70A resolution
• Chain: D
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R3030 R3048 R3091 R3168 I3220 V3221
• Catalytic site (residue number reindexed from 1): R27 R45 R88 R165 I217 V218
• Enzyme Commision number: 2.4.2.3: uridine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TDR	D	G3096 F3162 Q3166 R3168 E3196 M3197 I3220	G93 F159 Q163 R165 E193 M194 I217

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004850 uridine phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0047847 deoxyuridine phosphorylase activity

Biological Process

• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009166 nucleotide catabolic process
• GO:0044206 UMP salvage

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2hrd, PDBe:2hrd, PDBj:2hrd
• PDBsum: 2hrd
• UniProt: P0A1F6|UDP_SALTY Uridine phosphorylase (Gene Name=udp)