Structure of PDB 2h8d Chain D

Receptor sequence
>2h8dD (length=146) Species: 40690 (Trematomus bernacchii) [Search protein sequence]
VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYN
AEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDP
DNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
3D structure
PDB2h8d High resolution crystal structure of deoxy hemoglobin from Trematomus bernacchii at different pH values: The role of histidine residues in modulating the strength of the root effect.
ChainD
Resolution1.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D H41 F42 H63 K66 V67 L88 H92 L96 N102 F103 L106 L141 H41 F42 H63 K66 V67 L88 H92 L96 N102 F103 L106 L141
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2h8d, PDBe:2h8d, PDBj:2h8d
PDBsum2h8d
PubMed16909420
UniProtP80044|HBB_TREBE Hemoglobin subunit beta (Gene Name=hbb)

[Back to BioLiP]