Structure of PDB 2h61 Chain D

Receptor sequence
>2h61D (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE
QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
3D structure
PDB2h61 Structural and functional insights into RAGE activation by multimeric S100B.
ChainD
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA D S18 E21 D23 K26 E31 S19 E22 D24 K27 E32
BS02 CA D D61 D63 D65 E67 E72 D62 D64 D66 E68 E73
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048156 tau protein binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0007155 cell adhesion
GO:0007409 axonogenesis
GO:0007417 central nervous system development
GO:0007611 learning or memory
GO:0007613 memory
GO:0008284 positive regulation of cell population proliferation
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045666 positive regulation of neuron differentiation
GO:0048168 regulation of neuronal synaptic plasticity
GO:0097490 sympathetic neuron projection extension
GO:1990138 neuron projection extension
GO:1990845 adaptive thermogenesis
Cellular Component
GO:0001726 ruffle
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043025 neuronal cell body
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2h61, PDBe:2h61, PDBj:2h61
PDBsum2h61
PubMed17660747
UniProtP04271|S100B_HUMAN Protein S100-B (Gene Name=S100B)

[Back to BioLiP]