Structure of PDB 2h27 Chain D

Receptor sequence
>2h27D (length=69) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVR
SRIFRAREAIDNKVQPLIR
3D structure
PDB2h27 The structural basis for promoter -35 element recognition by the group IV sigma factors.
ChainD
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D P139 P166 G168 T169 S172 R173 R176 P18 P45 G47 T48 S51 R52 R55
BS02 dna D R149 S155 Y156 R171 F175 R178 R28 S34 Y35 R50 F54 R57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2h27, PDBe:2h27, PDBj:2h27
PDBsum2h27
PubMed16903784
UniProtP0AGB6|RPOE_ECOLI ECF RNA polymerase sigma-E factor (Gene Name=rpoE)

[Back to BioLiP]