Structure of PDB 2gj2 Chain D |
>2gj2D (length=79) Species: 92652 (Shrimp white spot syndrome virus) [Search protein sequence] |
ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGS TFVLNGGIEELRLLTGDSTLEIQPMIVPT |
|
PDB | 2gj2 Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites |
Chain | D |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CD |
D |
E31 C46 |
E30 C45 |
|
BS02 |
CD |
D |
D9 C46 |
D8 C45 |
|
|
|